Lineage for d1nbad_ (1nba D:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312886Fold c.33: Cysteine hydrolase [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 312887Superfamily c.33.1: Cysteine hydrolase [52499] (2 families) (S)
  5. 312888Family c.33.1.1: N-carbamoylsarcosine amidohydrolase [52500] (1 protein)
  6. 312889Protein N-carbamoylsarcosine amidohydrolase [52501] (1 species)
  7. 312890Species Arthrobacter sp. [52502] (1 PDB entry)
  8. 312894Domain d1nbad_: 1nba D: [31756]
    complexed with so4

Details for d1nbad_

PDB Entry: 1nba (more details), 2 Å

PDB Description: crystal structure analysis, refinement and enzymatic reaction mechanism of n-carbamoylsarcosine amidohydrolase from arthrobacter sp. at 2.0 angstroms resolution

SCOP Domain Sequences for d1nbad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbad_ c.33.1.1 (D:) N-carbamoylsarcosine amidohydrolase {Arthrobacter sp.}
tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
dpqpeveapadpv

SCOP Domain Coordinates for d1nbad_:

Click to download the PDB-style file with coordinates for d1nbad_.
(The format of our PDB-style files is described here.)

Timeline for d1nbad_: