Lineage for d1nbac_ (1nba C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22815Fold c.33: Cysteine hydrolase [52498] (1 superfamily)
  4. 22816Superfamily c.33.1: Cysteine hydrolase [52499] (2 families) (S)
  5. 22817Family c.33.1.1: N-carbamoylsarcosine amidohydrolase [52500] (1 protein)
  6. 22818Protein N-carbamoylsarcosine amidohydrolase [52501] (1 species)
  7. 22819Species Arthrobacter sp. [52502] (1 PDB entry)
  8. 22822Domain d1nbac_: 1nba C: [31755]

Details for d1nbac_

PDB Entry: 1nba (more details), 2 Å

PDB Description: crystal structure analysis, refinement and enzymatic reaction mechanism of n-carbamoylsarcosine amidohydrolase from arthrobacter sp. at 2.0 angstroms resolution

SCOP Domain Sequences for d1nbac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbac_ c.33.1.1 (C:) N-carbamoylsarcosine amidohydrolase {Arthrobacter sp.}
tfndiearlaavleeafeagtsiynergfkrrigygnrpavihidlanawtqpghpfscp
gmetiipnvqrineaarakgvpvfyttnvyrnrdassgtndmglwyskiptetlpadsyw
aqiddriapadgevvieknrasafpgtnlelfltsnridtlivtgataagcvrhtvedai
akgfrpiipretigdrvpgvvqwnlydidnkfgdvestdsvvqyldalpqfedtvpktls
dpqpeveapadpv

SCOP Domain Coordinates for d1nbac_:

Click to download the PDB-style file with coordinates for d1nbac_.
(The format of our PDB-style files is described here.)

Timeline for d1nbac_: