Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins) automatically mapped to Pfam PF00121 |
Protein automated matches [196175] (9 species) not a true protein |
Species Trypanosoma brucei [TaxId:5702] [271658] (9 PDB entries) |
Domain d5i3kb_: 5i3k B: [317545] automated match to d1tpfa_ complexed with na, pga |
PDB Entry: 5i3k (more details), 2.21 Å
SCOPe Domain Sequences for d5i3kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i3kb_ c.1.1.1 (B:) automated matches {Trypanosoma brucei [TaxId: 5702]} skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpq qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngfavggaslkpe fvdiikatq
Timeline for d5i3kb_: