Lineage for d5hd3a_ (5hd3 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2210736Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2210737Family d.110.3.1: PYP-like [55786] (3 proteins)
  6. 2210738Protein Photoactive yellow protein, PYP [55787] (1 species)
  7. 2210739Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [55788] (68 PDB entries)
    Uniprot P16113
  8. 2210785Domain d5hd3a_: 5hd3 A: [317510]
    automated match to d1nwza_

Details for d5hd3a_

PDB Entry: 5hd3 (more details), 1.6 Å

PDB Description: femtosecond structural dynamics drives the trans/cis isomerization in photoactive yellow protein: dark structure of photoactive yellow protein
PDB Compounds: (A:) Photoactive yellow protein

SCOPe Domain Sequences for d5hd3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hd3a_ d.110.3.1 (A:) Photoactive yellow protein, PYP {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigk
nffkdvapxtdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
fvkrv

SCOPe Domain Coordinates for d5hd3a_:

Click to download the PDB-style file with coordinates for d5hd3a_.
(The format of our PDB-style files is described here.)

Timeline for d5hd3a_: