SCOPe 2.06: Domain d5fnvc2: 5fnv C:246-439

Lineage for d5fnvc2 (5fnv C:246-439)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (5 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [278823] (2 PDB entries)

8. Domain d5fnvc2: 5fnv C:246-439 [317485]
   Other proteins in same PDB: d5fnva1, d5fnvb1, d5fnvb2, d5fnvc1, d5fnvd1, d5fnvd2, d5fnve_, d5fnvf1, d5fnvf2
   automated match to d4i50a2
   complexed with acp, ca, gdp, gtp, mes, mg, x3h

Details for d5fnvc2

PDB Entry: 5fnv, 2.61 Å

PDB Description: a new complex structure of tubulin with an alpha-beta unsaturated lactone

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5fnvc2:

Sequence; same for both SEQRES and ATOM records:

>d5fnvc2 d.79.2.1 (C:246-439) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

Timeline for d5fnvc2:

• d5fnvc2 is new in SCOPe 2.06-stable
  
• d5fnvc2 appears in SCOPe 2.07
  
• d5fnvc2 appears in the current release, SCOPe 2.08