Lineage for d5fere_ (5fer E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2939257Protein automated matches [190124] (13 species)
    not a true protein
  7. 2939272Species Human (Homo sapiens) [TaxId:9606] [186848] (52 PDB entries)
  8. 2939342Domain d5fere_: 5fer E: [317482]
    Other proteins in same PDB: d5ferc_, d5ferf_
    automated match to d2c4pa_
    complexed with zn

Details for d5fere_

PDB Entry: 5fer (more details), 2.34 Å

PDB Description: complex of trim25 ring with ubch5-ub
PDB Compounds: (E:) ubiquitin-conjugating enzyme e2 d1

SCOPe Domain Sequences for d5fere_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fere_ d.20.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkriqkelsdlqrdppahcragpvgddlfhwqatimgppdsayqggvffltvhfptdy
pfkppkiafttkiyhpninsngsikldilrsqwspaltvskvllsicsllcdpnpddplv
pdiaqiyksdkekynrharewtqkya

SCOPe Domain Coordinates for d5fere_:

Click to download the PDB-style file with coordinates for d5fere_.
(The format of our PDB-style files is described here.)

Timeline for d5fere_: