Lineage for d1d4oa_ (1d4o A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69230Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 69231Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
  5. 69267Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
  6. 69268Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 69269Species Cow (Bos taurus) [TaxId:9913] [52487] (1 PDB entry)
  8. 69270Domain d1d4oa_: 1d4o A: [31748]

Details for d1d4oa_

PDB Entry: 1d4o (more details), 1.21 Å

PDB Description: crystal structure of transhydrogenase domain iii at 1.2 angstroms resolution

SCOP Domain Sequences for d1d4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d4oa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Cow (Bos taurus)}
gthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlseqgkkvrfgihpva
grmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpnsiiag
mpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvres

SCOP Domain Coordinates for d1d4oa_:

Click to download the PDB-style file with coordinates for d1d4oa_.
(The format of our PDB-style files is described here.)

Timeline for d1d4oa_: