Class b: All beta proteins [48724] (180 folds) |
Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily) single sheet; 16 strands; meander |
Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) automatically mapped to Pfam PF02327 |
Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 proteins) |
Protein automated matches [190386] (4 species) not a true protein |
Species Chlorobium tepidum [TaxId:194439] [317468] (1 PDB entry) |
Domain d5h8zc_: 5h8z C: [317469] automated match to d3bsda_ complexed with bcl; mutant |
PDB Entry: 5h8z (more details), 1.8 Å
SCOPe Domain Sequences for d5h8zc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h8zc_ b.75.1.1 (C:) automated matches {Chlorobium tepidum [TaxId: 194439]} vttahsdyeivleggssswgkvkarakvnappaspllpadadvklnvkpldpakgfvris avfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrsd avrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfigp aftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdkl nrpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnfn vdaqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvakggvgqfeilyaq
Timeline for d5h8zc_: