Lineage for d5fc8e_ (5fc8 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2332675Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2333294Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2333295Protein automated matches [190220] (14 species)
    not a true protein
  7. 2333381Species Mouse (Mus musculus) [TaxId:10090] [272712] (12 PDB entries)
  8. 2333383Domain d5fc8e_: 5fc8 E: [317467]
    automated match to d1un0b_

Details for d5fc8e_

PDB Entry: 5fc8 (more details), 2.1 Å

PDB Description: mouse importin alpha: dengue 3 ns5 c-terminal nls peptide complex
PDB Compounds: (E:) Importin subunit alpha-1

SCOPe Domain Sequences for d5fc8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fc8e_ a.118.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qgtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgk
tdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgnia
gdgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldave
qilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpiv
tpalraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqi
qqvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnlls
akdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykasln
liekyfs

SCOPe Domain Coordinates for d5fc8e_:

Click to download the PDB-style file with coordinates for d5fc8e_.
(The format of our PDB-style files is described here.)

Timeline for d5fc8e_: