Lineage for d5faxb1 (5fax B:1-317)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873644Protein automated matches [190073] (16 species)
    not a true protein
  7. 2873671Species Bacillus halmapalus [TaxId:79882] [317439] (2 PDB entries)
  8. 2873675Domain d5faxb1: 5fax B:1-317 [317462]
    Other proteins in same PDB: d5faxa2, d5faxb2
    automated match to d1wmda2
    complexed with ca

Details for d5faxb1

PDB Entry: 5fax (more details), 2 Å

PDB Description: structure of subtilase subhal from bacillus halmapalus
PDB Compounds: (B:) Subtilase SubHal from Bacillus halmapalus

SCOPe Domain Sequences for d5faxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5faxb1 c.41.1.1 (B:1-317) automated matches {Bacillus halmapalus [TaxId: 79882]}
xdvargivkadvaqnnfglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
nandpnghgthvagsvlgnatnkgmapqanlvfqsimdsggglgglpanlqtlfsqaysa
garihtnswgapvngayttdsrnvddyvrkndmtilfaagnegpgsgtisapgtaknait
vgatenlrpsfgsyadninhvaqfssrgptrdgrikpdvmapgtyilsarsslapdssfw
anhdskyaymggtsmatpivagnvaqlrehfvknrgvtpkpsllkaaliagaadvglgfp
ngnqgwgrvtldkslnv

SCOPe Domain Coordinates for d5faxb1:

Click to download the PDB-style file with coordinates for d5faxb1.
(The format of our PDB-style files is described here.)

Timeline for d5faxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5faxb2