Lineage for d5fbzc2 (5fbz C:318-433)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2774997Species Bacillus halmapalus [TaxId:79882] [317441] (2 PDB entries)
  8. 2774999Domain d5fbzc2: 5fbz C:318-433 [317446]
    Other proteins in same PDB: d5fbza1, d5fbzb_, d5fbzc1, d5fbzd1
    automated match to d1wmda1
    complexed with ca

Details for d5fbzc2

PDB Entry: 5fbz (more details), 1.9 Å

PDB Description: structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a
PDB Compounds: (C:) Enzyme subtilase SubHal from Bacillus halmapalus

SCOPe Domain Sequences for d5fbzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fbzc2 b.18.1.0 (C:318-433) automated matches {Bacillus halmapalus [TaxId: 79882]}
afvnetsplstsqkatysftaqagkplkislvwsdapgsttasltlvndldlvitapngt
kyvgndftapydnnwdgrnnvenvfinapqsgtytvevqaynvpvgpqtfslaivh

SCOPe Domain Coordinates for d5fbzc2:

Click to download the PDB-style file with coordinates for d5fbzc2.
(The format of our PDB-style files is described here.)

Timeline for d5fbzc2: