Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.1: Subtilases [52744] (14 proteins) |
Protein automated matches [190073] (15 species) not a true protein |
Species Bacillus halmapalus [TaxId:79882] [317439] (2 PDB entries) |
Domain d5fbza1: 5fbz A:1-317 [317440] Other proteins in same PDB: d5fbza2, d5fbzb_, d5fbzc2, d5fbzd1 automated match to d1wmda2 complexed with ca |
PDB Entry: 5fbz (more details), 1.9 Å
SCOPe Domain Sequences for d5fbza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fbza1 c.41.1.1 (A:1-317) automated matches {Bacillus halmapalus [TaxId: 79882]} xdvargivkadvaqnnfglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn nandpnghgthvagsvlgnatnkgmapqanlvfqsimdsggglgglpanlqtlfsqaysa garihtnswgapvngayttdsrnvddyvrkndmtilfaagnegpgsgtisapgtaknait vgatenlrpsfgsyadninhvaqfssrgptrdgrikpdvmapgtyilsarsslapdssfw anhdskyaymggtsmatpivagnvaqlrehfvknrgvtpkpsllkaaliagaadvglgfp ngnqgwgrvtldkslnv
Timeline for d5fbza1:
View in 3D Domains from other chains: (mouse over for more information) d5fbzb_, d5fbzc1, d5fbzc2, d5fbzd1 |