Lineage for d5fbza1 (5fbz A:1-317)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129453Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2129454Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2129455Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 2129656Protein automated matches [190073] (15 species)
    not a true protein
  7. 2129680Species Bacillus halmapalus [TaxId:79882] [317439] (2 PDB entries)
  8. 2129681Domain d5fbza1: 5fbz A:1-317 [317440]
    Other proteins in same PDB: d5fbza2, d5fbzb_, d5fbzc2, d5fbzd1
    automated match to d1wmda2
    complexed with ca

Details for d5fbza1

PDB Entry: 5fbz (more details), 1.9 Å

PDB Description: structure of subtilase subhal from bacillus halmapalus - complex with chymotrypsin inhibitor ci2a
PDB Compounds: (A:) Enzyme subtilase SubHal from Bacillus halmapalus

SCOPe Domain Sequences for d5fbza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fbza1 c.41.1.1 (A:1-317) automated matches {Bacillus halmapalus [TaxId: 79882]}
xdvargivkadvaqnnfglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
nandpnghgthvagsvlgnatnkgmapqanlvfqsimdsggglgglpanlqtlfsqaysa
garihtnswgapvngayttdsrnvddyvrkndmtilfaagnegpgsgtisapgtaknait
vgatenlrpsfgsyadninhvaqfssrgptrdgrikpdvmapgtyilsarsslapdssfw
anhdskyaymggtsmatpivagnvaqlrehfvknrgvtpkpsllkaaliagaadvglgfp
ngnqgwgrvtldkslnv

SCOPe Domain Coordinates for d5fbza1:

Click to download the PDB-style file with coordinates for d5fbza1.
(The format of our PDB-style files is described here.)

Timeline for d5fbza1: