Lineage for d1zpdb1 (1zpd B:188-362)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312760Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 312761Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 312779Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (5 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 312811Protein Pyruvate decarboxylase [52478] (3 species)
    rudiment domain with a variant fold, lacks FAD-binding
  7. 312820Species Zymomonas mobilis [TaxId:542] [52481] (1 PDB entry)
  8. 312822Domain d1zpdb1: 1zpd B:188-362 [31742]
    Other proteins in same PDB: d1zpda2, d1zpda3, d1zpdb2, d1zpdb3, d1zpde2, d1zpde3, d1zpdf2, d1zpdf3

Details for d1zpdb1

PDB Entry: 1zpd (more details), 1.86 Å

PDB Description: pyruvate decarboxylase from zymomonas mobilis

SCOP Domain Sequences for d1zpdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpdb1 c.31.1.3 (B:188-362) Pyruvate decarboxylase {Zymomonas mobilis}
easdeaslnaavdetlkfianrdkvavlvgsklraagaeeaavkftdalggavatmaaak
sffpeenalyigtswgevsypgvektmkeadavialapvfndysttgwtdipdpkklvla
eprsvvvngirfpsvhlkdyltrlaqkvskktgsldffkslnagelkkaapadps

SCOP Domain Coordinates for d1zpdb1:

Click to download the PDB-style file with coordinates for d1zpdb1.
(The format of our PDB-style files is described here.)

Timeline for d1zpdb1: