Lineage for d5he1a3 (5he1 A:550-668)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071584Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2071585Protein automated matches [190052] (6 species)
    not a true protein
  7. 2071626Species Human (Homo sapiens) [TaxId:9606] [186914] (54 PDB entries)
  8. 2071695Domain d5he1a3: 5he1 A:550-668 [317390]
    Other proteins in same PDB: d5he1a1, d5he1a2, d5he1b_, d5he1g_
    automated match to d3krwa3
    complexed with mg, zs2

Details for d5he1a3

PDB Entry: 5he1 (more details), 3.15 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg224062
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5he1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5he1a3 b.55.1.0 (A:550-668) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

SCOPe Domain Coordinates for d5he1a3:

Click to download the PDB-style file with coordinates for d5he1a3.
(The format of our PDB-style files is described here.)

Timeline for d5he1a3: