Lineage for d5he1a1 (5he1 A:29-185)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004960Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2004961Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2005022Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2005023Protein automated matches [190464] (3 species)
    not a true protein
  7. 2005032Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)
  8. 2005063Domain d5he1a1: 5he1 A:29-185 [317388]
    Other proteins in same PDB: d5he1a2, d5he1a3, d5he1b_, d5he1g_
    automated match to d3v5wa1
    complexed with mg, zs2

Details for d5he1a1

PDB Entry: 5he1 (more details), 3.15 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg224062
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5he1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5he1a1 a.91.1.0 (A:29-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyee
ikkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqp
yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d5he1a1:

Click to download the PDB-style file with coordinates for d5he1a1.
(The format of our PDB-style files is described here.)

Timeline for d5he1a1: