Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (33 PDB entries) |
Domain d5dd6b2: 5dd6 B:108-213 [317368] automated match to d4jg1l2 |
PDB Entry: 5dd6 (more details), 1.7 Å
SCOPe Domain Sequences for d5dd6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dd6b2 b.1.1.0 (B:108-213) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} ravaapsvfifppsedqvksgtvsvvcllnnfypreasvkwkvdgvlktgnsqesvteqd skdntyslsstltlsntdyqshnvyacevthqglsspvtksfnrge
Timeline for d5dd6b2: