Lineage for d1powa1 (1pow A:183-365)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69230Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
  4. 69231Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
  5. 69243Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (3 proteins)
  6. 69261Protein Pyruvate oxidase [52476] (1 species)
  7. 69262Species Lactobacillus plantarum [TaxId:1590] [52477] (2 PDB entries)
  8. 69265Domain d1powa1: 1pow A:183-365 [31733]
    Other proteins in same PDB: d1powa2, d1powa3, d1powb2, d1powb3

Details for d1powa1

PDB Entry: 1pow (more details), 2.5 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum

SCOP Domain Sequences for d1powa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1powa1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

SCOP Domain Coordinates for d1powa1:

Click to download the PDB-style file with coordinates for d1powa1.
(The format of our PDB-style files is described here.)

Timeline for d1powa1: