SCOPe 2.08: Domain d5he0a3: 5he0 A:550-668

Lineage for d5he0a3 (5he0 A:550-668)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [317245] (4 PDB entries)

8. Domain d5he0a3: 5he0 A:550-668 [317325]
   Other proteins in same PDB: d5he0a1, d5he0a2, d5he0b_, d5he0g_
   automated match to d3krwa3
   complexed with 453

Details for d5he0a3

PDB Entry: 5he0, 2.56 Å

PDB Description: bovine grk2 in complex with gbetagamma subunits and ccg215022

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5he0a3:

Sequence; same for both SEQRES and ATOM records:

>d5he0a3 b.55.1.0 (A:550-668) automated matches {Cow (Bos taurus) [TaxId: 9913]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Timeline for d5he0a3:

• d5he0a3 first appeared in SCOPe 2.06
  
• d5he0a3 appears in SCOPe 2.07