Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
Protein automated matches [190052] (8 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [317245] (4 PDB entries) |
Domain d5he0a3: 5he0 A:550-668 [317325] Other proteins in same PDB: d5he0a1, d5he0a2, d5he0b_, d5he0g_ automated match to d3krwa3 complexed with 453 |
PDB Entry: 5he0 (more details), 2.56 Å
SCOPe Domain Sequences for d5he0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5he0a3 b.55.1.0 (A:550-668) automated matches {Cow (Bos taurus) [TaxId: 9913]} eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv eetqikerkclllkirggkqfvlqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp
Timeline for d5he0a3: