SCOPe 2.08: Domain d5he0a1: 5he0 A:30-185

Lineage for d5he0a1 (5he0 A:30-185)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [317242] (4 PDB entries)

8. Domain d5he0a1: 5he0 A:30-185 [317323]
   Other proteins in same PDB: d5he0a2, d5he0a3, d5he0b_, d5he0g_
   automated match to d3v5wa1
   complexed with 453

Details for d5he0a1

PDB Entry: 5he0, 2.56 Å

PDB Description: bovine grk2 in complex with gbetagamma subunits and ccg215022

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d5he0a1:

Sequence; same for both SEQRES and ATOM records:

>d5he0a1 a.91.1.0 (A:30-185) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefyeei
kkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfqpy
ieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

Timeline for d5he0a1:

• d5he0a1 first appeared in SCOPe 2.06
  
• d5he0a1 appears in SCOPe 2.07