Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) |
Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins) automatically mapped to Pfam PF00731 |
Protein automated matches [191111] (4 species) not a true protein |
Species Acetobacter aceti [TaxId:1457393] [311949] (18 PDB entries) |
Domain d4zmba_: 4zmb A: [317321] automated match to d1u11b_ complexed with act, edo, so4 |
PDB Entry: 4zmb (more details), 1.81 Å
SCOPe Domain Sequences for d4zmba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zmba_ c.23.8.1 (A:) automated matches {Acetobacter aceti [TaxId: 1457393]} sapvvgiimgsqsdwetmrhadallteleiphetlivvahrtpdrladyartaaerglnv iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg aknaallaasilalfnpalaarletwralqtasvpnspit
Timeline for d4zmba_: