Lineage for d5jhmb2 (5jhm B:304-405)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2361840Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2362784Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2362785Protein automated matches [190226] (64 species)
    not a true protein
  7. 2363098Species Zika virus [TaxId:64320] [317280] (5 PDB entries)
  8. 2363100Domain d5jhmb2: 5jhm B:304-405 [317318]
    Other proteins in same PDB: d5jhma1, d5jhmb1
    automated match to d4gsxa2

Details for d5jhmb2

PDB Entry: 5jhm (more details), 2 Å

PDB Description: crystal structure of zika virus envelope protein
PDB Compounds: (B:) envelope protein

SCOPe Domain Sequences for d5jhmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jhmb2 b.1.18.0 (B:304-405) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsgs

SCOPe Domain Coordinates for d5jhmb2:

Click to download the PDB-style file with coordinates for d5jhmb2.
(The format of our PDB-style files is described here.)

Timeline for d5jhmb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jhmb1