Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (5 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Pyruvate oxidase [52476] (1 species) binds FAD |
Species Lactobacillus plantarum [TaxId:1590] [52477] (2 PDB entries) |
Domain d1poxa1: 1pox A:183-365 [31731] Other proteins in same PDB: d1poxa2, d1poxa3, d1poxb2, d1poxb3 |
PDB Entry: 1pox (more details), 2.1 Å
SCOP Domain Sequences for d1poxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1poxa1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum} yasannyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas led
Timeline for d1poxa1: