SCOPe 2.06: Domain d5id7a1: 5id7 A:3-196

Lineage for d5id7a1 (5id7 A:3-196)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (78 PDB entries)
   Uniprot P02768 29-596

8. Domain d5id7a1: 5id7 A:3-196 [317302]
   automated match to d1n5ua1
   complexed with 6a4, peg, pge

Details for d5id7a1

PDB Entry: 5id7, 2.26 Å

PDB Description: crystal structure of human serum albumin in complex with phosphorodithioate derivative of myristoyl cyclic phosphatidic acid (cpa)

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5id7a1:

Sequence; same for both SEQRES and ATOM records:

>d5id7a1 a.126.1.1 (A:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Timeline for d5id7a1:

• d5id7a1 is new in SCOPe 2.06-stable
  
• d5id7a1 appears in SCOPe 2.07
  
• d5id7a1 appears in the current release, SCOPe 2.08