Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (35 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [317275] (1 PDB entry) |
Domain d5je8c2: 5je8 C:164-290 [317301] Other proteins in same PDB: d5je8a1, d5je8b1, d5je8b3, d5je8c1, d5je8d1 automated match to d1yb4a2 complexed with epe, gol, nad |
PDB Entry: 5je8 (more details), 2.1 Å
SCOPe Domain Sequences for d5je8c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5je8c2 a.100.1.0 (C:164-290) automated matches {Bacillus cereus [TaxId: 226900]} qidsgttvklinnlligfytagvsealtlakknnmdldkmfdilnvsygqsriyernyks fiapenyepgftvnllkkdlgfavdlakeselhlpvsemllnvydeasqagygendmaal ykkvseq
Timeline for d5je8c2: