Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.2: C-terminal domain of the electron transfer flavoprotein alpha subunit [52471] (1 protein) lacks strand 3; shares the FAD-binding mode with the pyruvate oxidase domain |
Protein C-terminal domain of the electron transfer flavoprotein alpha subunit [52472] (3 species) |
Species Paracoccus denitrificans [TaxId:266] [52474] (1 PDB entry) |
Domain d1efpc2: 1efp C:185-308 [31730] Other proteins in same PDB: d1efpa1, d1efpb_, d1efpc1, d1efpd_ complexed with amp, fad |
PDB Entry: 1efp (more details), 2.6 Å
SCOP Domain Sequences for d1efpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efpc2 c.31.1.2 (C:185-308) C-terminal domain of the electron transfer flavoprotein alpha subunit {Paracoccus denitrificans} sdrpeltsarrvvsggrglgskesfaiieeladklgaavgasraavdsgyapndwqvgqt gkvvapelyvavgisgaiqhlagmkdskvivainkdeeapifqiadyglvgdlfsvvpel tgkl
Timeline for d1efpc2:
View in 3D Domains from other chains: (mouse over for more information) d1efpa1, d1efpa2, d1efpb_, d1efpd_ |