SCOPe 2.06: Domain d5jhla2: 5jhl A:304-403

Lineage for d5jhla2 (5jhl A:304-403)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317280] (5 PDB entries)

8. Domain d5jhla2: 5jhl A:304-403 [317281]
   Other proteins in same PDB: d5jhla1
   automated match to d4gsxa2

Details for d5jhla2

PDB Entry: 5jhl, 3 Å

PDB Description: crystal structure of zika virus envelope protein in complex with a flavivirus broadly-protective antibody

PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d5jhla2:

Sequence; same for both SEQRES and ATOM records:

>d5jhla2 b.1.18.0 (A:304-403) automated matches {Zika virus [TaxId: 64320]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrs

Timeline for d5jhla2:

• d5jhla2 is new in SCOPe 2.06-stable
  
• d5jhla2 appears in SCOPe 2.07
  
• d5jhla2 appears in the current release, SCOPe 2.08