Lineage for d5jhla1 (5jhl A:1-303)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576583Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2576584Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2576629Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2576630Protein automated matches [227047] (10 species)
    not a true protein
  7. 2576649Species Zika virus [TaxId:64320] [317278] (5 PDB entries)
  8. 2576658Domain d5jhla1: 5jhl A:1-303 [317279]
    Other proteins in same PDB: d5jhla2, d5jhll1, d5jhll2
    automated match to d4gsxa1

Details for d5jhla1

PDB Entry: 5jhl (more details), 3 Å

PDB Description: crystal structure of zika virus envelope protein in complex with a flavivirus broadly-protective antibody
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d5jhla1:

Sequence, based on SEQRES records: (download)

>d5jhla1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhgsqhsgmivndtghetdenrakveitpnspraeatl
ggfgslgldceprtgldfsdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnke
alvefkdahakrqtvvvlgsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrl
kgv

Sequence, based on observed residues (ATOM records): (download)

>d5jhla1 f.10.1.0 (A:1-303) automated matches {Zika virus [TaxId: 64320]}
ircigvsnrdfvegmsggtwvdvvlehggcvtvmaqdkptvdielvtttvsnmaevrsyc
yeasisdmasdsrcptqgeayldkqsdtqyvckrtlvdrgwgngcglfgkgslvtcakfa
cskkmtgksiqpenleyrimlsvhnrakveitpnspraeatlggfgslgldceprtgldf
sdlyyltmnnkhwlvhkewfhdiplpwhagadtgtphwnnkealvefkdahakrqtvvvl
gsqegavhtalagaleaemdgakgrlssghlkcrlkmdklrlkgv

SCOPe Domain Coordinates for d5jhla1:

Click to download the PDB-style file with coordinates for d5jhla1.
(The format of our PDB-style files is described here.)

Timeline for d5jhla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5jhla2