SCOPe 2.06: Domain d5he1g_: 5he1 G:

Lineage for d5he1g_ (5he1 G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (28 PDB entries)

8. Domain d5he1g_: 5he1 G: [317259]
   Other proteins in same PDB: d5he1a1, d5he1a2, d5he1a3, d5he1b_
   automated match to d2trcg_
   complexed with mg, zs2

Details for d5he1g_

PDB Entry: 5he1, 3.15 Å

PDB Description: human grk2 in complex with gbetagamma subunits and ccg224062

PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d5he1g_:

Sequence; same for both SEQRES and ATOM records:

>d5he1g_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
asiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkf
fs

Timeline for d5he1g_:

• d5he1g_ is new in SCOPe 2.06-stable
  
• d5he1g_ appears in SCOPe 2.07
  
• d5he1g_ appears in the current release, SCOPe 2.08