Lineage for d5fppb1 (5fpp B:5-543)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2474358Protein Acetylcholinesterase [53476] (6 species)
  7. 2474399Species Mouse (Mus musculus) [TaxId:10090] [53479] (36 PDB entries)
  8. 2474441Domain d5fppb1: 5fpp B:5-543 [317257]
    Other proteins in same PDB: d5fppa2, d5fppb2
    automated match to d1maac_
    complexed with ae3, co3, hi6, nag, p6g

Details for d5fppb1

PDB Entry: 5fpp (more details), 2.4 Å

PDB Description: structure of a pre-reaction ternary complex between sarin- acetylcholinesterase and hi-6
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d5fppb1:

Sequence, based on SEQRES records: (download)

>d5fppb1 c.69.1.1 (B:5-543) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt
fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy
sgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwvq
eniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsagea
rrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvd
gdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvr
igvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgar
vyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfa
rtgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat

Sequence, based on observed residues (ATOM records): (download)

>d5fppb1 c.69.1.1 (B:5-543) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
dpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldatt
fqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggfy
sgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwvq
eniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsagea
rrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdflsdt
pealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpqas
dlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayife
hrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdpnd
prdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat

SCOPe Domain Coordinates for d5fppb1:

Click to download the PDB-style file with coordinates for d5fppb1.
(The format of our PDB-style files is described here.)

Timeline for d5fppb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fppb2