SCOPe 2.06: Domain d5ifra1: 5ifr A:2-147

Lineage for d5ifra1 (5ifr A:2-147)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)

8. Domain d5ifra1: 5ifr A:2-147 [317253]
   Other proteins in same PDB: d5ifra2, d5ifrb_
   automated match to d2gmia1
   complexed with gol

Details for d5ifra1

PDB Entry: 5ifr, 2.2 Å

PDB Description: structure of the stable ube2d3-ubdha conjugate

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 D3

SCOPe Domain Sequences for d5ifra1:

Sequence; same for both SEQRES and ATOM records:

>d5ifra1 d.20.1.1 (A:2-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrinkelsdlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrdkynrisrewtqkyam

Timeline for d5ifra1:

• d5ifra1 is new in SCOPe 2.06-stable
  
• d5ifra1 appears in the current release, SCOPe 2.07