Lineage for d5a0yb2 (5a0y B:189-443)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719655Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2719656Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2719657Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2719718Protein automated matches [315354] (4 species)
    not a true protein
  7. 2719719Species Methanothermobacter marburgensis [TaxId:145263] [315355] (2 PDB entries)
  8. 2719721Domain d5a0yb2: 5a0y B:189-443 [317248]
    Other proteins in same PDB: d5a0ya1, d5a0yb1, d5a0yc_, d5a0yd1, d5a0ye1, d5a0yf_
    automated match to d1hbnb1
    complexed with cl, com, f43, k, mg, na, tp7

Details for d5a0yb2

PDB Entry: 5a0y (more details), 1.1 Å

PDB Description: methyl-coenzyme m reductase from methanothermobacter marburgensis at 1.1 a resolution
PDB Compounds: (B:) Methyl-coenzyme M reductase I subunit beta

SCOPe Domain Sequences for d5a0yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a0yb2 a.89.1.1 (B:189-443) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
gyalrnimvnhvvaatlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d5a0yb2:

Click to download the PDB-style file with coordinates for d5a0yb2.
(The format of our PDB-style files is described here.)

Timeline for d5a0yb2: