Lineage for d5ayaa_ (5aya A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997604Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2997605Protein automated matches [190418] (31 species)
    not a true protein
  7. 2998003Species Serratia marcescens [TaxId:615] [193993] (9 PDB entries)
  8. 2998011Domain d5ayaa_: 5aya A: [317234]
    automated match to d4ax1b_
    complexed with na, so4, x8z, zn

Details for d5ayaa_

PDB Entry: 5aya (more details), 2.02 Å

PDB Description: crystal structure of metallo-beta-lactamase smb-1 bound to l-captopril
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d5ayaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ayaa_ d.157.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]}
rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg
sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad
syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac
raiaaagrkrletrlasek

SCOPe Domain Coordinates for d5ayaa_:

Click to download the PDB-style file with coordinates for d5ayaa_.
(The format of our PDB-style files is described here.)

Timeline for d5ayaa_: