SCOP 1.55: Domain d1auva1: 1auv A:112-213

Lineage for d1auva1 (1auv A:112-213)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.5: Synapsin Ia domain [52463] (1 protein)

6. Protein Synapsin Ia domain [52464] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52465] (2 PDB entries)

8. Domain d1auva1: 1auv A:112-213 [31723]
   Other proteins in same PDB: d1auva2, d1auvb2

Details for d1auva1

PDB Entry: 1auv, 2.15 Å

PDB Description: structure of the c domain of synapsin ia from bovine brain

SCOP Domain Sequences for d1auva1:

Sequence; same for both SEQRES and ATOM records:

>d1auva1 c.30.1.5 (A:112-213) Synapsin Ia domain {Cow (Bos taurus)}
aarvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrng
vkvvrslkpdfvlirqhafsmarngdyrslviglqyagipsi

Timeline for d1auva1:

• d1auva1 appears in SCOP 1.57
  
• d1auva1 appears in the current release, SCOPe 2.08