SCOPe 2.07: Domain d5dd0l2: 5dd0 L:108-211

Lineage for d5dd0l2 (5dd0 L:108-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (33 PDB entries)

8. Domain d5dd0l2: 5dd0 L:108-211 [317222]
   automated match to d4jg1l2

Details for d5dd0l2

PDB Entry: 5dd0, 2.49 Å

PDB Description: crystal structures in an anti-hiv antibody lineage from immunization of rhesus macaques

PDB Compounds: (L:) anti-hiv antibody dh570 fab heavy light

SCOPe Domain Sequences for d5dd0l2:

Sequence; same for both SEQRES and ATOM records:

>d5dd0l2 b.1.1.0 (L:108-211) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
ravaapsvfifppsedqvksgtvsvvcllnnfypreasvkwkvdgvlktgnsqesvteqd
skdntyslsstltlsntdyqshnvyacevthqglsspvtksfnr

Timeline for d5dd0l2:

• d5dd0l2 first appeared in SCOPe 2.06
  
• d5dd0l2 appears in the current release, SCOPe 2.08