SCOPe 2.06: Domain d5ccta_: 5cct A:

Lineage for d5ccta_ (5cct A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.0: automated matches [191644] (1 protein)
   not a true family

6. Protein automated matches [191182] (16 species)
   not a true protein

7. Species Staphylococcus phage [TaxId:53369] [256154] (11 PDB entries)

8. Domain d5ccta_: 5cct A: [317194]
   automated match to d3zeza_
   complexed with dup, mg; mutant

Details for d5ccta_

PDB Entry: 5cct, 2.4 Å

PDB Description: staphylococcus bacteriophage 80alpha dutpase g164s mutant with dupnhpp.

PDB Compounds: (A:) dutpase

SCOPe Domain Sequences for d5ccta_:

Sequence; same for both SEQRES and ATOM records:

>d5ccta_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]}
tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
tsrsgvsskthlvietgkidagyhgnlginikndheddkmqtiflrnidnekifekerhl
yklgsyriekgeriaqlvivpiwtpelkqveefesvsergeksfgssgv

Timeline for d5ccta_:

• d5ccta_ is new in SCOPe 2.06-stable
  
• d5ccta_ appears in SCOPe 2.07
  
• d5ccta_ appears in the current release, SCOPe 2.08