SCOPe 2.06: Domain d5b1xb1: 5b1x B:106-234

Lineage for d5b1xb1 (5b1x B:106-234)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d5b1xb1: 5b1x B:106-234 [317190]
   Other proteins in same PDB: d5b1xa2, d5b1xb2, d5b1xc2, d5b1xd2
   automated match to d1b6ea_
   complexed with ca, man, nag

Details for d5b1xb1

PDB Entry: 5b1x, 2.9 Å

PDB Description: crystal structure of human dendritic cell inhibitory receptor (dcir) c-type lectin domain in complex with biantennary glycan

PDB Compounds: (B:) C-type lectin domain family 4 member A

SCOPe Domain Sequences for d5b1xb1:

Sequence; same for both SEQRES and ATOM records:

>d5b1xb1 d.169.1.0 (B:106-234) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpknwksfssncyfistesaswqdsekdcarmeahllvintqeeqdfifqnlqeesayfv
glsdpegqrhwqwvdqtpynesstfwhprepsdpnercvvlnfrkspkrwgwndvnclgp
qrsvcemmk

Timeline for d5b1xb1:

• d5b1xb1 is new in SCOPe 2.06-stable
  
• d5b1xb1 appears in SCOPe 2.07
  
• d5b1xb1 appears in the current release, SCOPe 2.08