Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
Protein Methyl-coenzyme M reductase gamma chain [55090] (3 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [55091] (15 PDB entries) |
Domain d5a0yf_: 5a0y F: [317174] Other proteins in same PDB: d5a0ya1, d5a0ya2, d5a0yb1, d5a0yb2, d5a0yd1, d5a0yd2, d5a0ye1, d5a0ye2 automated match to d1hbnc_ complexed with cl, com, f43, k, mg, na, tp7 |
PDB Entry: 5a0y (more details), 1.1 Å
SCOPe Domain Sequences for d5a0yf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a0yf_ d.58.31.1 (F:) Methyl-coenzyme M reductase gamma chain {Methanobacterium thermoautotrophicum [TaxId: 145262]} aqyypgttkvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq iietrerdlekiskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt grvemvknqigdeldepvdlgepldeetlmekttiyrvdgeayrddveaveimqrihvlr sqggfnle
Timeline for d5a0yf_: