SCOPe 2.07: Domain d4zt7b2: 4zt7 B:607-767

Lineage for d4zt7b2 (4zt7 B:607-767)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries)

8. Domain d4zt7b2: 4zt7 B:607-767 [317152]
   Other proteins in same PDB: d4zt7a1, d4zt7b1, d4zt7b3
   automated match to d4eg8b2
   protein/RNA complex; complexed with 4rc, dms, gol, met

Details for d4zt7b2

PDB Entry: 4zt7, 2.4 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor n-[(4r)-6,8-dichloro-1,2,3,4-tetrahydroquinolin-4-yl]-n'-(5-fluoro- 3h-imidazo[4,5-b]pyridin-2-yl)propane-1,3-diamine (chem 1717)

PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4zt7b2:

Sequence; same for both SEQRES and ATOM records:

>d4zt7b2 a.27.1.0 (B:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

Timeline for d4zt7b2:

• d4zt7b2 first appeared in SCOPe 2.06
  
• d4zt7b2 appears in the current release, SCOPe 2.08