Class b: All beta proteins [48724] (180 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein automated matches [190433] (12 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (32 PDB entries) |
Domain d4rvib_: 4rvi B: [317128] automated match to d4njsa_ complexed with g52 |
PDB Entry: 4rvi (more details), 1.99 Å
SCOPe Domain Sequences for d4rvib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rvib_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrykprmiggiggfvkvrqyd qipieicghkvigtvlvgptptniigrnlmtqlgctlnf
Timeline for d4rvib_: