Lineage for d4rvib_ (4rvi B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2799131Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2800628Protein automated matches [190433] (12 species)
    not a true protein
  7. 2800672Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (32 PDB entries)
  8. 2800734Domain d4rvib_: 4rvi B: [317128]
    automated match to d4njsa_
    complexed with g52

Details for d4rvib_

PDB Entry: 4rvi (more details), 1.99 Å

PDB Description: crystal structure of multidrug-resistant clinical isolate a02 hiv-1 protease in complex with non-peptidic inhibitor, grl0519
PDB Compounds: (B:) hiv-1 protease

SCOPe Domain Sequences for d4rvib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rvib_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwqrpivtikvggqlkealldtgaddtvledmelpgrykprmiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlmtqlgctlnf

SCOPe Domain Coordinates for d4rvib_:

Click to download the PDB-style file with coordinates for d4rvib_.
(The format of our PDB-style files is described here.)

Timeline for d4rvib_: