Lineage for d4zlka2 (4zlk A:63-787)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2449392Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. 2449533Protein automated matches [190129] (6 species)
    not a true protein
  7. 2449606Species Mouse (Mus musculus) [TaxId:10090] [187256] (4 PDB entries)
  8. 2449609Domain d4zlka2: 4zlk A:63-787 [317127]
    Other proteins in same PDB: d4zlka1, d4zlkb_
    automated match to d1oe9a2
    complexed with ca

Details for d4zlka2

PDB Entry: 4zlk (more details), 2.5 Å

PDB Description: crystal structure of mouse myosin-5a in complex with calcium-bound calmodulin
PDB Compounds: (A:) Unconventional myosin-Va

SCOPe Domain Sequences for d4zlka2:

Sequence, based on SEQRES records: (download)

>d4zlka2 c.37.1.9 (A:63-787) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rnpdilvgendltalsylhepavlhnlrvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrty
lleksrvvfqaeeernyhifyqlcasaklpefkmlrlgnadsfhytkqggspmiegvdda
kemahtrqactllgisesyqmgifrilagilhlgnvgfasrdsdsctippkhepltifcd
lmgvdyeemchwlchrklatatetyikpisklqatnardalakhiyaklfnwivdhvnqa
lhsavkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqi
pwtlidfydnqpcinliesklgildlldeeckmpkgtddtwaqklynthlnkcalfekpr
msnkafiikhfadkveyqcegfleknkdtvfeeqikvlksskfkmlpelfqddekaispt
satssgrtpltrvpvkptkgrpgqtakehkktvghqfrnslhllmetlnattphyvrcik
pndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdvlgd
rkqtcknvleklildkdkyqfgktkiffragqvayleklradklraaciriqktirgwll
rkryl

Sequence, based on observed residues (ATOM records): (download)

>d4zlka2 c.37.1.9 (A:63-787) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rnpdilvgendltalsylhepavlhnlrvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsnveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrtylleksr
vvfqaeeernyhifyqlcasaklpefkmlrlgnadsfhytkqggspmiegvddakemaht
rqactllgisesyqmgifrilagilhlgnvgfasrdsdsctippkhepltifcdlmgvdy
eemchwlchrklatetyikpisklqatnardalakhiyaklfnwivdhvnqalhsavkqh
sfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipwidfydn
qpcinliesklgildlldeeckmpkgtddtwaqklynthlnkcalfekprmsnkafiikh
fadkveyqcegfleknkdtvfeeqikvlksskfkmlpelfqkehkktvghqfrnslhllm
etlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeff
sryrvlmkqkdvlgdrkqtcknvleklildkdkyqfgktkiffragqvayleklradklr
aaciriqktirgwllrkryl

SCOPe Domain Coordinates for d4zlka2:

Click to download the PDB-style file with coordinates for d4zlka2.
(The format of our PDB-style files is described here.)

Timeline for d4zlka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zlka1
View in 3D
Domains from other chains:
(mouse over for more information)
d4zlkb_