Lineage for d5dw6b2 (5dw6 B:230-505)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493292Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2493293Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2493579Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2493580Protein automated matches [191112] (16 species)
    not a true protein
  7. 2493585Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries)
  8. 2493593Domain d5dw6b2: 5dw6 B:230-505 [317096]
    Other proteins in same PDB: d5dw6a3
    automated match to d4eu3a2
    complexed with 0t1, act, imd

Details for d5dw6b2

PDB Entry: 5dw6 (more details), 1.55 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6) bound to acetate and the coa analogue 3'-phosphoadenosine 5'-(o-(n-propyl-r-pantothenamide)) pyrophosphate (mx)
PDB Compounds: (B:) Succinyl-CoA:acetate CoA-transferase

SCOPe Domain Sequences for d5dw6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dw6b2 c.124.1.0 (B:230-505) automated matches {Acetobacter aceti [TaxId: 435]}
apfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenl
vgyseviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsnsp
giirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakg
gkisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdy
fdralknsfgkhtphlltealswhqrfidtgtmlps

SCOPe Domain Coordinates for d5dw6b2:

Click to download the PDB-style file with coordinates for d5dw6b2.
(The format of our PDB-style files is described here.)

Timeline for d5dw6b2: