Lineage for d4zt5a2 (4zt5 A:607-767)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319167Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2319168Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2319221Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2319222Protein automated matches [226872] (13 species)
    not a true protein
  7. 2319267Species Trypanosoma brucei [TaxId:999953] [226468] (29 PDB entries)
  8. 2319284Domain d4zt5a2: 4zt5 A:607-767 [317064]
    Other proteins in same PDB: d4zt5a1, d4zt5b1, d4zt5b3
    automated match to d4eg8b2
    protein/RNA complex; complexed with 4rn, dms, gol, met, so4

Details for d4zt5a2

PDB Entry: 4zt5 (more details), 2.35 Å

PDB Description: trypanosoma brucei methionyl-trna synthetase in complex with inhibitor (2s)-n-(3,5-dichlorobenzyl)-n'-(1h-imidazo[4,5-b]pyridin-2-yl)-2- methylpropane-1,3-diamine (chem 1655)
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4zt5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zt5a2 a.27.1.0 (A:607-767) automated matches {Trypanosoma brucei [TaxId: 999953]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

SCOPe Domain Coordinates for d4zt5a2:

Click to download the PDB-style file with coordinates for d4zt5a2.
(The format of our PDB-style files is described here.)

Timeline for d4zt5a2: