Lineage for d1jdbb4 (1jdb B:556-676)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694027Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 694028Superfamily c.30.1: PreATP-grasp domain [52440] (7 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 694029Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 694052Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 694053Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
  8. 694087Domain d1jdbb4: 1jdb B:556-676 [31706]
    Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2

Details for d1jdbb4

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli
PDB Compounds: (B:) carbamoyl phosphate synthetase

SCOP Domain Sequences for d1jdbb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbb4 c.30.1.1 (B:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
tdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdrl
yfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedre
r

SCOP Domain Coordinates for d1jdbb4:

Click to download the PDB-style file with coordinates for d1jdbb4.
(The format of our PDB-style files is described here.)

Timeline for d1jdbb4: