Lineage for d1bxrg4 (1bxr G:556-676)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694027Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 694028Superfamily c.30.1: PreATP-grasp domain [52440] (7 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 694029Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 694052Protein Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains [52450] (1 species)
    duplication: CPS large subunit contains two full BC-like lobes: carboxyphosphate and carbamoyl phosphate domains
  7. 694053Species Escherichia coli [TaxId:562] [52451] (10 PDB entries)
  8. 694125Domain d1bxrg4: 1bxr G:556-676 [31704]
    Other proteins in same PDB: d1bxra1, d1bxra2, d1bxra5, d1bxra6, d1bxrb1, d1bxrb2, d1bxrc1, d1bxrc2, d1bxrc5, d1bxrc6, d1bxrd1, d1bxrd2, d1bxre1, d1bxre2, d1bxre5, d1bxre6, d1bxrf1, d1bxrf2, d1bxrg1, d1bxrg2, d1bxrg5, d1bxrg6, d1bxrh1, d1bxrh2
    complexed with anp, cl, k, mn, net, orn

Details for d1bxrg4

PDB Entry: 1bxr (more details), 2.1 Å

PDB Description: structure of carbamoyl phosphate synthetase complexed with the atp analog amppnp
PDB Compounds: (G:) carbamoyl-phosphate synthase

SCOP Domain Sequences for d1bxrg4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxrg4 c.30.1.1 (G:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOP Domain Coordinates for d1bxrg4:

Click to download the PDB-style file with coordinates for d1bxrg4.
(The format of our PDB-style files is described here.)

Timeline for d1bxrg4: