Lineage for d5j6ba1 (5j6b A:1-477)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481726Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2481727Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2482164Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2482165Protein automated matches [190683] (56 species)
    not a true protein
  7. 2482319Species Burkholderia thailandensis [TaxId:271848] [256344] (2 PDB entries)
  8. 2482322Domain d5j6ba1: 5j6b A:1-477 [317007]
    Other proteins in same PDB: d5j6ba2
    automated match to d2impa_
    complexed with cl, ndp

Details for d5j6ba1

PDB Entry: 5j6b (more details), 1.95 Å

PDB Description: crystal structure of aldehyde dehydrogenase from burkholderia thailandensis in covelent complex with nadph
PDB Compounds: (A:) aldehyde dehydrogenase

SCOPe Domain Sequences for d5j6ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j6ba1 c.82.1.0 (A:1-477) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mlketypyylaneavyanaelevtdkytgkvatrvaladasaidaaiaaavgaqkplral
pafrrqailehcvarfrerfdelaqalcieagkpindskgevtrlidtfrvaaeesvrie
gglvnleispraqgysgyykrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpas
rtpigaliigevlaetdlpkgafsilpahrdgadlfttderfkllsftgsptvgwelkkk
agkkkvvlelggnaaaivdadqrevldyvverlafgayyqsgqscigvqriiahadvyda
lrekliaktrslkmgdpkdpatfvgpmisesearrlagwmeaavaagakivaggkvdgam
featllegvgrdqdlyrkeafgpvallerfsdfddalarvndsdfglqagvftdslshaq
rawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmtelrlmvvrrr

SCOPe Domain Coordinates for d5j6ba1:

Click to download the PDB-style file with coordinates for d5j6ba1.
(The format of our PDB-style files is described here.)

Timeline for d5j6ba1: