Lineage for d1ce8g4 (1ce8 G:556-676)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22644Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 22645Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 22646Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 22655Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)
  7. 22656Species Escherichia coli [TaxId:562] [52451] (7 PDB entries)
  8. 22696Domain d1ce8g4: 1ce8 G:556-676 [31696]
    Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2

Details for d1ce8g4

PDB Entry: 1ce8 (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

SCOP Domain Sequences for d1ce8g4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce8g4 c.30.1.1 (G:556-676) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
stdrekimvlgggpnrigqgiefdyccvhaslalredgyetimvncnpetvstdydtsdr
lyfepvtledvleivriekpkgvivqyggqtplklaraleaagvpvigtspdaidraedr
e

SCOP Domain Coordinates for d1ce8g4:

Click to download the PDB-style file with coordinates for d1ce8g4.
(The format of our PDB-style files is described here.)

Timeline for d1ce8g4: