Lineage for d5elvb1 (5elv B:3-263)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914848Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)
  8. 2914887Domain d5elvb1: 5elv B:3-263 [316940]
    Other proteins in same PDB: d5elva2, d5elvb2
    automated match to d5ftia_
    complexed with 5px, act, cl, glu, gol, peg, so4

Details for d5elvb1

PDB Entry: 5elv (more details), 1.92 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j-l504-n775) in complex with glutamate and bpam-521 at 1.92 a resolution
PDB Compounds: (B:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5elvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5elvb1 c.94.1.1 (B:3-263) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltityvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls
eqglldklknkwwydkgecgs

SCOPe Domain Coordinates for d5elvb1:

Click to download the PDB-style file with coordinates for d5elvb1.
(The format of our PDB-style files is described here.)

Timeline for d5elvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5elvb2