Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily) |
Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) |
Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins) |
Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species) |
Species Escherichia coli [TaxId:562] [52451] (7 PDB entries) |
Domain d1ce8e3: 1ce8 E:1-127 [31693] Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2 |
PDB Entry: 1ce8 (more details), 2.1 Å
SCOP Domain Sequences for d1ce8e3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ce8e3 c.30.1.1 (E:1-127) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli} mpkrtdiksililgagpivigqacefdysgaqackalreegyrvinvnsnpatimtdpem adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata daidkae
Timeline for d1ce8e3:
View in 3D Domains from other chains: (mouse over for more information) d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2 |