SCOPe 2.08: Domain d5d2kb_: 5d2k B:

Lineage for d5d2kb_ (5d2k B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.177: FAH [56528] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure

4. Superfamily d.177.1: FAH [56529] (2 families)

5. Family d.177.1.0: automated matches [191367] (1 protein)
   not a true family

6. Protein automated matches [190444] (5 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [316881] (6 PDB entries)

8. Domain d5d2kb_: 5d2k B: [316923]
   automated match to d2eb4a_
   complexed with act, edo, mg, oog

Details for d5d2kb_

PDB Entry: 5d2k, 1.57 Å

PDB Description: 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate

PDB Compounds: (B:) 4-oxalocrotonate decarboxylase NahK

SCOPe Domain Sequences for d5d2kb_:

Sequence; same for both SEQRES and ATOM records:

>d5d2kb_ d.177.1.0 (B:) automated matches {Pseudomonas putida [TaxId: 303]}
nrtltreqvlalaehienaelnvhdigkvtndfpemtfadaydvqweirrrkeargnkiv
glkmgltswakmaqmgvetpiygfladyfsvpdggvvdcsklihpkieaeisvvtkaplh
gpgchlgdviaaidyviptvevidsryenfkfdpisvvadnasstrfitggrmasleevd
lrtlgvvmekngevvelgagaavlghplssvamlanllaergehipagtfimtggitaav
pvapgdnitvryqglgsvsarfi

Timeline for d5d2kb_:

• d5d2kb_ first appeared in SCOPe 2.06
  
• d5d2kb_ appears in SCOPe 2.07