Lineage for d5ddka2 (5ddk A:230-505)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922594Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2922595Protein automated matches [191112] (17 species)
    not a true protein
  7. 2922600Species Acetobacter aceti [TaxId:435] [226493] (16 PDB entries)
  8. 2922647Domain d5ddka2: 5ddk A:230-505 [316920]
    Other proteins in same PDB: d5ddka3
    automated match to d4eu3a2
    complexed with cl, coa, imd

Details for d5ddka2

PDB Entry: 5ddk (more details), 2.13 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6-n347a) in complex with coa
PDB Compounds: (A:) Acetyl-CoA hydrolase

SCOPe Domain Sequences for d5ddka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ddka2 c.124.1.0 (A:230-505) automated matches {Acetobacter aceti [TaxId: 435]}
apfaapdetakaiagylldffghevkqnrlppsllplqsgvgnvanavleglkegpfenl
vgyseviqdgmlamldsgrmriasassfslspeaaeeinnrmdffrskiilrqqdvsasp
giirrlgciamngmieadiygnvnstrvmgskmmngiggsgdfarssylsiflspstakg
gkisaivpmaahvdhimqdaqifvteqgladlrglspvqrareiiskcahpdyrpmlqdy
fdralknsfgkhtphlltealswhqrfidtgtmlps

SCOPe Domain Coordinates for d5ddka2:

Click to download the PDB-style file with coordinates for d5ddka2.
(The format of our PDB-style files is described here.)

Timeline for d5ddka2: